ETV6 monoclonal antibody (M01), clone 3B10
  • ETV6 monoclonal antibody (M01), clone 3B10

ETV6 monoclonal antibody (M01), clone 3B10

Ref: AB-H00002120-M01
ETV6 monoclonal antibody (M01), clone 3B10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ETV6.
Información adicional
Size 100 ug
Gene Name ETV6
Gene Alias TEL|TEL/ABL
Gene Description ets variant 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ETV6 (AAH43399, 1 a.a. ~ 452 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2120
Clone Number 3B10
Iso type IgG1 Kappa

Enviar uma mensagem


ETV6 monoclonal antibody (M01), clone 3B10

ETV6 monoclonal antibody (M01), clone 3B10