ETV5 polyclonal antibody (A01)
  • ETV5 polyclonal antibody (A01)

ETV5 polyclonal antibody (A01)

Ref: AB-H00002119-A01
ETV5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ETV5.
Información adicional
Size 50 uL
Gene Name ETV5
Gene Alias ERM
Gene Description ets variant 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ETV5 (NP_004445, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2119

Enviar uma mensagem


ETV5 polyclonal antibody (A01)

ETV5 polyclonal antibody (A01)