ETV1 monoclonal antibody (M01), clone 2A8
  • ETV1 monoclonal antibody (M01), clone 2A8

ETV1 monoclonal antibody (M01), clone 2A8

Ref: AB-H00002115-M01
ETV1 monoclonal antibody (M01), clone 2A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ETV1.
Información adicional
Size 100 ug
Gene Name ETV1
Gene Alias DKFZp781L0674|ER81|MGC104699|MGC120533|MGC120534
Gene Description ets variant 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ETV1 (NP_004947, 148 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2115
Clone Number 2A8
Iso type IgG1 Kappa

Enviar uma mensagem


ETV1 monoclonal antibody (M01), clone 2A8

ETV1 monoclonal antibody (M01), clone 2A8