ETV1 polyclonal antibody (A01)
  • ETV1 polyclonal antibody (A01)

ETV1 polyclonal antibody (A01)

Ref: AB-H00002115-A01
ETV1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ETV1.
Información adicional
Size 50 uL
Gene Name ETV1
Gene Alias DKFZp781L0674|ER81|MGC104699|MGC120533|MGC120534
Gene Description ets variant 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ETV1 (NP_004947, 148 a.a. ~ 257 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2115

Enviar uma mensagem


ETV1 polyclonal antibody (A01)

ETV1 polyclonal antibody (A01)