ETS2 polyclonal antibody (A01)
  • ETS2 polyclonal antibody (A01)

ETS2 polyclonal antibody (A01)

Ref: AB-H00002114-A01
ETS2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ETS2.
Información adicional
Size 50 uL
Gene Name ETS2
Gene Alias ETS2IT1
Gene Description v-ets erythroblastosis virus E26 oncogene homolog 2 (avian)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YEENSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ETS2 (AAH42954, 178 a.a. ~ 277 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2114

Enviar uma mensagem


ETS2 polyclonal antibody (A01)

ETS2 polyclonal antibody (A01)