ETS1 monoclonal antibody (M02), clone 2G10
  • ETS1 monoclonal antibody (M02), clone 2G10

ETS1 monoclonal antibody (M02), clone 2G10

Ref: AB-H00002113-M02
ETS1 monoclonal antibody (M02), clone 2G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ETS1.
Información adicional
Size 100 ug
Gene Name ETS1
Gene Alias ETS-1|EWSR2|FLJ10768
Gene Description v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq SEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ETS1 (AAH17314.1, 173 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2113
Clone Number 2G10
Iso type IgG2a Kappa

Enviar uma mensagem


ETS1 monoclonal antibody (M02), clone 2G10

ETS1 monoclonal antibody (M02), clone 2G10