ETS1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ETS1 purified MaxPab rabbit polyclonal antibody (D01P)

ETS1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002113-D01P
ETS1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ETS1 protein.
Información adicional
Size 100 ug
Gene Name ETS1
Gene Alias ETS-1|EWSR2|FLJ10768
Gene Description v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,PLA-Ce
Immunogen Prot. Seq MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ETS1 (NP_005229.1, 1 a.a. ~ 441 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2113

Enviar uma mensagem


ETS1 purified MaxPab rabbit polyclonal antibody (D01P)

ETS1 purified MaxPab rabbit polyclonal antibody (D01P)