ESRRG purified MaxPab mouse polyclonal antibody (B01P)
  • ESRRG purified MaxPab mouse polyclonal antibody (B01P)

ESRRG purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002104-B01P
ESRRG purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ESRRG protein.
Información adicional
Size 50 ug
Gene Name ESRRG
Gene Alias DKFZp781L1617|ERR3|FLJ16023|KIAA0832|NR3B3
Gene Description estrogen-related receptor gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ESRRG (NP_996317.1, 1 a.a. ~ 435 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2104

Enviar uma mensagem


ESRRG purified MaxPab mouse polyclonal antibody (B01P)

ESRRG purified MaxPab mouse polyclonal antibody (B01P)