ESRRA polyclonal antibody (A01)
  • ESRRA polyclonal antibody (A01)

ESRRA polyclonal antibody (A01)

Ref: AB-H00002101-A01
ESRRA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ESRRA.
Información adicional
Size 50 uL
Gene Name ESRRA
Gene Alias ERR1|ERRa|ERRalpha|ESRL1|NR3B1
Gene Description estrogen-related receptor alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq LFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAGLGELGAALLQLVRRLQALRLEREEYVLLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ESRRA (NP_004442, 231 a.a. ~ 330 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2101

Enviar uma mensagem


ESRRA polyclonal antibody (A01)

ESRRA polyclonal antibody (A01)