ESR1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ESR1 purified MaxPab rabbit polyclonal antibody (D01P)

ESR1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002099-D01P
ESR1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ESR1 protein.
Información adicional
Size 100 ug
Gene Name ESR1
Gene Alias DKFZp686N23123|ER|ESR|ESRA|Era|NR3A1
Gene Description estrogen receptor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ESR1 (AAI28574.1, 1 a.a. ~ 595 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2099

Enviar uma mensagem


ESR1 purified MaxPab rabbit polyclonal antibody (D01P)

ESR1 purified MaxPab rabbit polyclonal antibody (D01P)