ERH monoclonal antibody (M07), clone 1H4
  • ERH monoclonal antibody (M07), clone 1H4

ERH monoclonal antibody (M07), clone 1H4

Ref: AB-H00002079-M07
ERH monoclonal antibody (M07), clone 1H4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ERH.
Información adicional
Size 100 ug
Gene Name ERH
Gene Alias DROER|FLJ27340
Gene Description enhancer of rudimentary homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ERH (AAH14301, 1 a.a. ~ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2079
Clone Number 1H4
Iso type IgG1 Kappa

Enviar uma mensagem


ERH monoclonal antibody (M07), clone 1H4

ERH monoclonal antibody (M07), clone 1H4