ERG polyclonal antibody (A01)
  • ERG polyclonal antibody (A01)

ERG polyclonal antibody (A01)

Ref: AB-H00002078-A01
ERG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ERG.
Información adicional
Size 50 uL
Gene Name ERG
Gene Alias erg-3|p55
Gene Description v-ets erythroblastosis virus E26 oncogene homolog (avian)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ERG (NP_891548, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2078

Enviar uma mensagem


ERG polyclonal antibody (A01)

ERG polyclonal antibody (A01)