ERCC2 monoclonal antibody (M04), clone S3
  • ERCC2 monoclonal antibody (M04), clone S3

ERCC2 monoclonal antibody (M04), clone S3

Ref: AB-H00002068-M04
ERCC2 monoclonal antibody (M04), clone S3

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ERCC2.
Información adicional
Size 100 ug
Gene Name ERCC2
Gene Alias COFS2|EM9|MGC102762|MGC126218|MGC126219|TTD|XPD
Gene Description excision repair cross-complementing rodent repair deficiency, complementation group 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ERCC2 (AAH08346, 1 a.a. ~ 405 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2068
Clone Number S3
Iso type IgG1 Kappa

Enviar uma mensagem


ERCC2 monoclonal antibody (M04), clone S3

ERCC2 monoclonal antibody (M04), clone S3