ERBB2 polyclonal antibody (A01)
  • ERBB2 polyclonal antibody (A01)

ERBB2 polyclonal antibody (A01)

Ref: AB-H00002064-A01
ERBB2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ERBB2.
Información adicional
Size 50 uL
Gene Name ERBB2
Gene Alias CD340|HER-2|HER-2/neu|HER2|NEU|NGL|TKR1
Gene Description v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ERBB2 (NP_004439, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2064

Enviar uma mensagem


ERBB2 polyclonal antibody (A01)

ERBB2 polyclonal antibody (A01)