EPS8 purified MaxPab mouse polyclonal antibody (B01P)
  • EPS8 purified MaxPab mouse polyclonal antibody (B01P)

EPS8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002059-B01P
EPS8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EPS8 protein.
Información adicional
Size 50 ug
Gene Name EPS8
Gene Alias -
Gene Description epidermal growth factor receptor pathway substrate 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EPS8 (NP_004438.3, 1 a.a. ~ 822 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2059

Enviar uma mensagem


EPS8 purified MaxPab mouse polyclonal antibody (B01P)

EPS8 purified MaxPab mouse polyclonal antibody (B01P)