EPOR monoclonal antibody (M01), clone 3D10
  • EPOR monoclonal antibody (M01), clone 3D10

EPOR monoclonal antibody (M01), clone 3D10

Ref: AB-H00002057-M01
EPOR monoclonal antibody (M01), clone 3D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EPOR.
Información adicional
Size 100 ug
Gene Name EPOR
Gene Alias MGC138358
Gene Description erythropoietin receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq PDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPOR (NP_000112, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2057
Clone Number 3D10
Iso type IgG2b Kappa

Enviar uma mensagem


EPOR monoclonal antibody (M01), clone 3D10

EPOR monoclonal antibody (M01), clone 3D10