EPHX2 purified MaxPab mouse polyclonal antibody (B02P)
  • EPHX2 purified MaxPab mouse polyclonal antibody (B02P)

EPHX2 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00002053-B02P
EPHX2 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EPHX2 protein.
Información adicional
Size 50 ug
Gene Name EPHX2
Gene Alias CEH|SEH
Gene Description epoxide hydrolase 2, cytoplasmic
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EPHX2 (NP_001970.2, 1 a.a. ~ 555 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2053

Enviar uma mensagem


EPHX2 purified MaxPab mouse polyclonal antibody (B02P)

EPHX2 purified MaxPab mouse polyclonal antibody (B02P)