EPHB1 purified MaxPab mouse polyclonal antibody (B01P)
  • EPHB1 purified MaxPab mouse polyclonal antibody (B01P)

EPHB1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002047-B01P
EPHB1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EPHB1 protein.
Información adicional
Size 50 ug
Gene Name EPHB1
Gene Alias ELK|EPHT2|FLJ37986|Hek6|NET
Gene Description EPH receptor B1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALDYLLLLLLASAVAAMEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EPHB1 (NP_004432.1, 1 a.a. ~ 984 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2047

Enviar uma mensagem


EPHB1 purified MaxPab mouse polyclonal antibody (B01P)

EPHB1 purified MaxPab mouse polyclonal antibody (B01P)