EPHA5 monoclonal antibody (M02), clone 5C3
  • EPHA5 monoclonal antibody (M02), clone 5C3

EPHA5 monoclonal antibody (M02), clone 5C3

Ref: AB-H00002044-M02
EPHA5 monoclonal antibody (M02), clone 5C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EPHA5.
Información adicional
Size 100 ug
Gene Name EPHA5
Gene Alias CEK7|EHK1|HEK7|TYRO4
Gene Description EPH receptor A5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPHA5 (NP_004430, 234 a.a. ~ 333 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2044
Clone Number 5C3
Iso type IgG1 Kappa

Enviar uma mensagem


EPHA5 monoclonal antibody (M02), clone 5C3

EPHA5 monoclonal antibody (M02), clone 5C3