STOM polyclonal antibody (A01)
  • STOM polyclonal antibody (A01)

STOM polyclonal antibody (A01)

Ref: AB-H00002040-A01
STOM polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant STOM.
Información adicional
Size 50 uL
Gene Name STOM
Gene Alias BND7|EPB7|EPB72
Gene Description stomatin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNADSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STOM (NP_004090, 59 a.a. ~ 142 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2040

Enviar uma mensagem


STOM polyclonal antibody (A01)

STOM polyclonal antibody (A01)