EPB41L2 purified MaxPab rabbit polyclonal antibody (D01P)
  • EPB41L2 purified MaxPab rabbit polyclonal antibody (D01P)

EPB41L2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002037-D01P
EPB41L2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EPB41L2 protein.
Información adicional
Size 100 ug
Gene Name EPB41L2
Gene Alias 4.1-G|DKFZp781D1972|DKFZp781H1755
Gene Description erythrocyte membrane protein band 4.1-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEKHAKGQVLFDKVCEHLNLLE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EPB41L2 (AAH34718.1, 1 a.a. ~ 633 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2037

Enviar uma mensagem


EPB41L2 purified MaxPab rabbit polyclonal antibody (D01P)

EPB41L2 purified MaxPab rabbit polyclonal antibody (D01P)