EPB41 polyclonal antibody (A01)
  • EPB41 polyclonal antibody (A01)

EPB41 polyclonal antibody (A01)

Ref: AB-H00002035-A01
EPB41 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EPB41.
Información adicional
Size 50 uL
Gene Name EPB41
Gene Alias 4.1R|EL1|HE
Gene Description erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPB41 (AAH39079, 116 a.a. ~ 225 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2035

Enviar uma mensagem


EPB41 polyclonal antibody (A01)

EPB41 polyclonal antibody (A01)