EP300 monoclonal antibody (M01J), clone 1B1
  • EP300 monoclonal antibody (M01J), clone 1B1

EP300 monoclonal antibody (M01J), clone 1B1

Ref: AB-H00002033-M01J
EP300 monoclonal antibody (M01J), clone 1B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EP300.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name EP300
Gene Alias KAT3B|p300
Gene Description E1A binding protein p300
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA,IF
Immunogen Prot. Seq PPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EP300 (NP_001420, 731 a.a. ~ 830 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2033
Clone Number 1B1
Iso type IgG1

Enviar uma mensagem


EP300 monoclonal antibody (M01J), clone 1B1

EP300 monoclonal antibody (M01J), clone 1B1