EMX2 monoclonal antibody (M04), clone 3C11
  • EMX2 monoclonal antibody (M04), clone 3C11

EMX2 monoclonal antibody (M04), clone 3C11

Ref: AB-H00002018-M04
EMX2 monoclonal antibody (M04), clone 3C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EMX2.
Información adicional
Size 100 ug
Gene Name EMX2
Gene Alias -
Gene Description empty spiracles homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq HSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EMX2 (NP_004089, 103 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2018
Clone Number 3C11
Iso type IgG2b Kappa

Enviar uma mensagem


EMX2 monoclonal antibody (M04), clone 3C11

EMX2 monoclonal antibody (M04), clone 3C11