EMX2 purified MaxPab mouse polyclonal antibody (B01P)
  • EMX2 purified MaxPab mouse polyclonal antibody (B01P)

EMX2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002018-B01P
EMX2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EMX2 protein.
Información adicional
Size 50 ug
Gene Name EMX2
Gene Alias -
Gene Description empty spiracles homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEGSDSQQKKKGTHHINRWRIATKQASPEEIDVTSDD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EMX2 (NP_004089.1, 1 a.a. ~ 252 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2018

Enviar uma mensagem


EMX2 purified MaxPab mouse polyclonal antibody (B01P)

EMX2 purified MaxPab mouse polyclonal antibody (B01P)