EMP3 monoclonal antibody (M03), clone 2C4
  • EMP3 monoclonal antibody (M03), clone 2C4

EMP3 monoclonal antibody (M03), clone 2C4

Ref: AB-H00002014-M03
EMP3 monoclonal antibody (M03), clone 2C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EMP3.
Información adicional
Size 100 ug
Gene Name EMP3
Gene Alias YMP
Gene Description epithelial membrane protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EMP3 (NP_001416.1, 25 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2014
Clone Number 2C4
Iso type IgG1 Kappa

Enviar uma mensagem


EMP3 monoclonal antibody (M03), clone 2C4

EMP3 monoclonal antibody (M03), clone 2C4