EMP3 purified MaxPab rabbit polyclonal antibody (D01P)
  • EMP3 purified MaxPab rabbit polyclonal antibody (D01P)

EMP3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002014-D01P
EMP3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EMP3 protein.
Información adicional
Size 100 ug
Gene Name EMP3
Gene Alias YMP
Gene Description epithelial membrane protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EMP3 (NP_001416.1, 1 a.a. ~ 163 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2014

Enviar uma mensagem


EMP3 purified MaxPab rabbit polyclonal antibody (D01P)

EMP3 purified MaxPab rabbit polyclonal antibody (D01P)