View larger
Mouse monoclonal antibody raised against a partial recombinant MARK2.
AB-H00002011-M01
New product
MARK2 monoclonal antibody (M01), clone 3B12
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | MARK2 |
| Gene Alias | EMK1|MGC99619|PAR-1|Par1b |
| Gene Description | MAP/microtubule affinity-regulating kinase 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | QAAGPAIPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPG |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | MARK2 (AAH08771, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 2011 |
| Clone Number | 3B12 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant MARK2.