MARK2 purified MaxPab rabbit polyclonal antibody (D01P)
  • MARK2 purified MaxPab rabbit polyclonal antibody (D01P)

MARK2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002011-D01P
MARK2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MARK2 protein.
Información adicional
Size 100 ug
Gene Name MARK2
Gene Alias EMK1|MGC99619|PAR-1|Par1b
Gene Description MAP/microtubule affinity-regulating kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MIRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MARK2 (NP_001034558.1, 1 a.a. ~ 755 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2011

Enviar uma mensagem


MARK2 purified MaxPab rabbit polyclonal antibody (D01P)

MARK2 purified MaxPab rabbit polyclonal antibody (D01P)