ELK1 monoclonal antibody (M01), clone 2G6
  • ELK1 monoclonal antibody (M01), clone 2G6

ELK1 monoclonal antibody (M01), clone 2G6

Ref: AB-H00002002-M01
ELK1 monoclonal antibody (M01), clone 2G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ELK1.
Información adicional
Size 100 ug
Gene Name ELK1
Gene Alias -
Gene Description ELK1, member of ETS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq YYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ELK1 (NP_005220, 67 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2002
Clone Number 2G6
Iso type IgG2a Kappa

Enviar uma mensagem


ELK1 monoclonal antibody (M01), clone 2G6

ELK1 monoclonal antibody (M01), clone 2G6