ELF3 monoclonal antibody (M04), clone 1F12
  • ELF3 monoclonal antibody (M04), clone 1F12

ELF3 monoclonal antibody (M04), clone 1F12

Ref: AB-H00001999-M04
ELF3 monoclonal antibody (M04), clone 1F12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ELF3.
Información adicional
Size 100 ug
Gene Name ELF3
Gene Alias EPR-1|ERT|ESE-1|ESX
Gene Description E74-like factor 3 (ets domain transcription factor, epithelial-specific )
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ELF3 (AAH03569, 262 a.a. ~ 371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1999
Clone Number 1F12
Iso type IgG1 Kappa

Enviar uma mensagem


ELF3 monoclonal antibody (M04), clone 1F12

ELF3 monoclonal antibody (M04), clone 1F12