ELAVL4 monoclonal antibody (M01), clone 6B9
  • ELAVL4 monoclonal antibody (M01), clone 6B9

ELAVL4 monoclonal antibody (M01), clone 6B9

Ref: AB-H00001996-M01
ELAVL4 monoclonal antibody (M01), clone 6B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ELAVL4.
Información adicional
Size 100 ug
Gene Name ELAVL4
Gene Alias HUD|PNEM
Gene Description ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ELAVL4 (NP_068771, 312 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1996
Clone Number 6B9
Iso type IgG1 Kappa

Enviar uma mensagem


ELAVL4 monoclonal antibody (M01), clone 6B9

ELAVL4 monoclonal antibody (M01), clone 6B9