ELAVL3 purified MaxPab mouse polyclonal antibody (B01P)
  • ELAVL3 purified MaxPab mouse polyclonal antibody (B01P)

ELAVL3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001995-B01P
ELAVL3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ELAVL3 protein.
Información adicional
Size 50 ug
Gene Name ELAVL3
Gene Alias DKFZp547J036|HUC|HUCL|MGC20653|PLE21
Gene Description ELAV (embryonic lethal, abnormal vision, Drosophila)-like 3 (Hu antigen C)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAIDTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPRTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKTGQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ELAVL3 (AAH11875, 1 a.a. ~ 367 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1995

Enviar uma mensagem


ELAVL3 purified MaxPab mouse polyclonal antibody (B01P)

ELAVL3 purified MaxPab mouse polyclonal antibody (B01P)