ELA1 monoclonal antibody (M02), clone 4H5
  • ELA1 monoclonal antibody (M02), clone 4H5

ELA1 monoclonal antibody (M02), clone 4H5

Ref: AB-H00001990-M02
ELA1 monoclonal antibody (M02), clone 4H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ELA1.
Información adicional
Size 100 ug
Gene Name ELA1
Gene Alias -
Gene Description elastase 1, pancreatic
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq LAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ELA1 (NP_001962.3, 159 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1990
Clone Number 4H5
Iso type IgG2a Kappa

Enviar uma mensagem


ELA1 monoclonal antibody (M02), clone 4H5

ELA1 monoclonal antibody (M02), clone 4H5