EIF5 purified MaxPab rabbit polyclonal antibody (D01P)
  • EIF5 purified MaxPab rabbit polyclonal antibody (D01P)

EIF5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001983-D01P
EIF5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EIF5 protein.
Información adicional
Size 100 ug
Gene Name EIF5
Gene Alias EIF-5|EIF-5A
Gene Description eukaryotic translation initiation factor 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EIF5 (AAH32866.1, 1 a.a. ~ 431 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1983

Enviar uma mensagem


EIF5 purified MaxPab rabbit polyclonal antibody (D01P)

EIF5 purified MaxPab rabbit polyclonal antibody (D01P)