EIF4G1 polyclonal antibody (A01)
  • EIF4G1 polyclonal antibody (A01)

EIF4G1 polyclonal antibody (A01)

Ref: AB-H00001981-A01
EIF4G1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EIF4G1.
Información adicional
Size 50 uL
Gene Name EIF4G1
Gene Alias DKFZp686A1451|EIF4F|EIF4G|p220
Gene Description eukaryotic translation initiation factor 4 gamma, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF4G1 (NP_886553, 1500 a.a. ~ 1599 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1981

Enviar uma mensagem


EIF4G1 polyclonal antibody (A01)

EIF4G1 polyclonal antibody (A01)