EIF4EBP2 monoclonal antibody (M04), clone 2G8
  • EIF4EBP2 monoclonal antibody (M04), clone 2G8

EIF4EBP2 monoclonal antibody (M04), clone 2G8

Ref: AB-H00001979-M04
EIF4EBP2 monoclonal antibody (M04), clone 2G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EIF4EBP2.
Información adicional
Size 100 ug
Gene Name EIF4EBP2
Gene Alias 4EBP2|PHASII
Gene Description eukaryotic translation initiation factor 4E binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF4EBP2 (NP_004087, 61 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1979
Clone Number 2G8
Iso type IgG2a Kappa

Enviar uma mensagem


EIF4EBP2 monoclonal antibody (M04), clone 2G8

EIF4EBP2 monoclonal antibody (M04), clone 2G8