EIF4EBP1 monoclonal antibody (M01), clone 4F3-H2
  • EIF4EBP1 monoclonal antibody (M01), clone 4F3-H2

EIF4EBP1 monoclonal antibody (M01), clone 4F3-H2

Ref: AB-H00001978-M01
EIF4EBP1 monoclonal antibody (M01), clone 4F3-H2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant EIF4EBP1.
Información adicional
Size 100 ug
Gene Name EIF4EBP1
Gene Alias 4E-BP1|4EBP1|BP-1|MGC4316|PHAS-I
Gene Description eukaryotic translation initiation factor 4E binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce,IF
Immunogen Prot. Seq MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF4EBP1 (AAH04459, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1978
Clone Number 4F3-H2
Iso type IgG1 Kappa

Enviar uma mensagem


EIF4EBP1 monoclonal antibody (M01), clone 4F3-H2

EIF4EBP1 monoclonal antibody (M01), clone 4F3-H2