EIF4A2 polyclonal antibody (A01)
  • EIF4A2 polyclonal antibody (A01)

EIF4A2 polyclonal antibody (A01)

Ref: AB-H00001974-A01
EIF4A2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EIF4A2.
Información adicional
Size 50 uL
Gene Name EIF4A2
Gene Alias BM-010|DDX2B|EIF4A|EIF4F
Gene Description eukaryotic translation initiation factor 4A, isoform 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF4A2 (NP_001958, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1974

Enviar uma mensagem


EIF4A2 polyclonal antibody (A01)

EIF4A2 polyclonal antibody (A01)