EPHA2 polyclonal antibody (A01)
  • EPHA2 polyclonal antibody (A01)

EPHA2 polyclonal antibody (A01)

Ref: AB-H00001969-A01
EPHA2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EPHA2.
Información adicional
Size 50 uL
Gene Name EPHA2
Gene Alias ECK
Gene Description EPH receptor A2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPHA2 (AAH37166, 204 a.a. ~ 326 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1969

Enviar uma mensagem


EPHA2 polyclonal antibody (A01)

EPHA2 polyclonal antibody (A01)