EIF2S3 monoclonal antibody (M03), clone 1H3
  • EIF2S3 monoclonal antibody (M03), clone 1H3

EIF2S3 monoclonal antibody (M03), clone 1H3

Ref: AB-H00001968-M03
EIF2S3 monoclonal antibody (M03), clone 1H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EIF2S3.
Información adicional
Size 100 ug
Gene Name EIF2S3
Gene Alias EIF2|EIF2G|EIF2gamma|eIF-2gA
Gene Description eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF2S3 (NP_001406, 383 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1968
Clone Number 1H3
Iso type IgG2a Kappa

Enviar uma mensagem


EIF2S3 monoclonal antibody (M03), clone 1H3

EIF2S3 monoclonal antibody (M03), clone 1H3