EIF2B1 purified MaxPab mouse polyclonal antibody (B01P)
  • EIF2B1 purified MaxPab mouse polyclonal antibody (B01P)

EIF2B1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001967-B01P
EIF2B1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EIF2B1 protein.
Información adicional
Size 50 ug
Gene Name EIF2B1
Gene Alias EIF-2B|EIF-2Balpha|EIF2B|EIF2BA|MGC117409|MGC125868|MGC125869
Gene Description eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKAD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EIF2B1 (NP_001405.1, 1 a.a. ~ 305 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1967

Enviar uma mensagem


EIF2B1 purified MaxPab mouse polyclonal antibody (B01P)

EIF2B1 purified MaxPab mouse polyclonal antibody (B01P)