EGR2 monoclonal antibody (M03), clone 1G5
  • EGR2 monoclonal antibody (M03), clone 1G5

EGR2 monoclonal antibody (M03), clone 1G5

Ref: AB-H00001959-M03
EGR2 monoclonal antibody (M03), clone 1G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EGR2.
Información adicional
Size 100 ug
Gene Name EGR2
Gene Alias AT591|CMT1D|CMT4E|DKFZp686J1957|FLJ14547|KROX20
Gene Description early growth response 2 (Krox-20 homolog, Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EGR2 (NP_000390.2, 217 a.a. ~ 293 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1959
Clone Number 1G5
Iso type IgG2b Kappa

Enviar uma mensagem


EGR2 monoclonal antibody (M03), clone 1G5

EGR2 monoclonal antibody (M03), clone 1G5