EGR1 monoclonal antibody (M05), clone 6A10
  • EGR1 monoclonal antibody (M05), clone 6A10

EGR1 monoclonal antibody (M05), clone 6A10

Ref: AB-H00001958-M05
EGR1 monoclonal antibody (M05), clone 6A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EGR1.
Información adicional
Size 100 ug
Gene Name EGR1
Gene Alias AT225|G0S30|KROX-24|NGFI-A|TIS8|ZIF-268|ZNF225
Gene Description early growth response 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EGR1 (NP_001955, 444 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1958
Clone Number 6A10
Iso type IgG2b Kappa

Enviar uma mensagem


EGR1 monoclonal antibody (M05), clone 6A10

EGR1 monoclonal antibody (M05), clone 6A10