EGF monoclonal antibody (M01C), clone 2F1
  • EGF monoclonal antibody (M01C), clone 2F1

EGF monoclonal antibody (M01C), clone 2F1

Ref: AB-H00001950-M01C
EGF monoclonal antibody (M01C), clone 2F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EGF.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 200 uL
Gene Name EGF
Gene Alias HOMG4|URG
Gene Description epidermal growth factor (beta-urogastrone)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWKLRHA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EGF (NP_001954, 926 a.a. ~ 1025 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In condensed culture supernatant
Gene ID 1950
Clone Number 2F1
Iso type IgG2b Kappa

Enviar uma mensagem


EGF monoclonal antibody (M01C), clone 2F1

EGF monoclonal antibody (M01C), clone 2F1