EFNB2 polyclonal antibody (A01)
  • EFNB2 polyclonal antibody (A01)

EFNB2 polyclonal antibody (A01)

Ref: AB-H00001948-A01
EFNB2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EFNB2.
Información adicional
Size 50 uL
Gene Name EFNB2
Gene Alias EPLG5|HTKL|Htk-L|LERK5|MGC126226|MGC126227|MGC126228
Gene Description ephrin-B2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EFNB2 (NP_004084, 28 a.a. ~ 127 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1948

Enviar uma mensagem


EFNB2 polyclonal antibody (A01)

EFNB2 polyclonal antibody (A01)