EEF1G monoclonal antibody (M03), clone S1
  • EEF1G monoclonal antibody (M03), clone S1

EEF1G monoclonal antibody (M03), clone S1

Ref: AB-H00001937-M03
EEF1G monoclonal antibody (M03), clone S1

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant EEF1G.
Información adicional
Size 100 ug
Gene Name EEF1G
Gene Alias EF1G|GIG35
Gene Description eukaryotic translation elongation factor 1 gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,S-ELISA,ELISA,IF
Immunogen Prot. Seq MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYHVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHDKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EEF1G (AAH15813.1, 1 a.a. ~ 437 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1937
Clone Number S1
Iso type IgG1 Kappa

Enviar uma mensagem


EEF1G monoclonal antibody (M03), clone S1

EEF1G monoclonal antibody (M03), clone S1