EEF1B2 monoclonal antibody (M17), clone 3H7
  • EEF1B2 monoclonal antibody (M17), clone 3H7

EEF1B2 monoclonal antibody (M17), clone 3H7

Ref: AB-H00001933-M17
EEF1B2 monoclonal antibody (M17), clone 3H7

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant EEF1B2.
Información adicional
Size 100 ug
Gene Name EEF1B2
Gene Alias EEF1B|EEF1B1|EF1B
Gene Description eukaryotic translation elongation factor 1 beta 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGADMLEEQITAFEDYVQSMDVAAFNKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EEF1B2 (AAH00211, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1933
Clone Number 3H7
Iso type IgG1 Kappa

Enviar uma mensagem


EEF1B2 monoclonal antibody (M17), clone 3H7

EEF1B2 monoclonal antibody (M17), clone 3H7