EEF1A2 polyclonal antibody (A01)
  • EEF1A2 polyclonal antibody (A01)

EEF1A2 polyclonal antibody (A01)

Ref: AB-H00001917-A01
EEF1A2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EEF1A2.
Información adicional
Size 50 uL
Gene Name EEF1A2
Gene Alias EEF1AL|EF-1-alpha-2|EF1A|FLJ41696|HS1|STN|STNL
Gene Description eukaryotic translation elongation factor 1 alpha 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq HTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EEF1A2 (NP_001949, 364 a.a. ~ 462 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1917

Enviar uma mensagem


EEF1A2 polyclonal antibody (A01)

EEF1A2 polyclonal antibody (A01)