PHC1 monoclonal antibody (M05), clone 3G1
  • PHC1 monoclonal antibody (M05), clone 3G1

PHC1 monoclonal antibody (M05), clone 3G1

Ref: AB-H00001911-M05
PHC1 monoclonal antibody (M05), clone 3G1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PHC1.
Información adicional
Size 100 ug
Gene Name PHC1
Gene Alias EDR1|HPH1|RAE28
Gene Description polyhomeotic homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANY*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PHC1 (NP_004417, 751 a.a. ~ 851 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1911
Clone Number 3G1
Iso type IgG2b Kappa

Enviar uma mensagem


PHC1 monoclonal antibody (M05), clone 3G1

PHC1 monoclonal antibody (M05), clone 3G1